PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01000456G0310
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family HSF
Protein Properties Length: 150aa    MW: 16797.6 Da    PI: 4.6247
Description HSF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01000456G0310genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HSF_DNA-bind80.13.5e-251373262
                     HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHTTE CS
     HSF_DNA-bind  2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmYgF 62
                     Fl+k+y++++d+ +++++sw e++++fvv+ + efa ++Lp+yFkh+nf+SFvRQLn+Y+ 
  PH01000456G0310 13 FLTKTYQLVDDPCTDHVVSWGEDETTFVVWRPPEFAMDLLPNYFKHNNFSSFVRQLNTYNH 73
                     9**********************************************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.108.0E-27472IPR011991Winged helix-turn-helix DNA-binding domain
SMARTSM004152.3E-249119IPR000232Heat shock factor (HSF)-type, DNA-binding
SuperFamilySSF467856.39E-231275IPR011991Winged helix-turn-helix DNA-binding domain
PfamPF004475.4E-211373IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000561.7E-151336IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000561.7E-155163IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000561.7E-156476IPR000232Heat shock factor (HSF)-type, DNA-binding
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 150 aa     Download sequence    Send to blast
MESSHAKPVP APFLTKTYQL VDDPCTDHVV SWGEDETTFV VWRPPEFAMD LLPNYFKHNN  60
FSSFVRQLNT YNHVEPVPPP TPTPPASCRL VELGPAERGA SPRPRQRGDD TAVKLFGVRL  120
NEGKKRRVQL EEEEGDGDHD DDDQGSDQV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5d5u_B2e-159722688Heat shock factor protein 1
5d5v_B2e-159722688Heat shock factor protein 1
5d5v_D2e-159722688Heat shock factor protein 1
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0639521e-68AK063952.1 Oryza sativa Japonica Group cDNA clone:001-123-F07, full insert sequence.
GenBankAK0993541e-68AK099354.1 Oryza sativa Japonica Group cDNA clone:J033042P04, full insert sequence.
GenBankAP0046711e-68AP004671.2 Oryza sativa Japonica Group genomic DNA, chromosome 7, PAC clone:P0524G08.
GenBankAP0052921e-68AP005292.5 Oryza sativa Japonica Group genomic DNA, chromosome 7, BAC clone:OJ1340_C08.
GenBankAP0149631e-68AP014963.1 Oryza sativa Japonica Group DNA, chromosome 7, cultivar: Nipponbare, complete sequence.
GenBankAY3444941e-68AY344494.1 Oryza sativa (japonica cultivar-group) heat shock factor RHSF12 mRNA, complete cds.
GenBankCP0126151e-68CP012615.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 7 sequence.
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP12137394
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G46264.16e-40heat shock transcription factor B4